Protein Info for GFF715 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 82 to 108 (27 residues), see Phobius details amino acids 130 to 136 (7 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 201 to 217 (17 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 277 to 304 (28 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details PF03600: CitMHS" amino acids 21 to 307 (287 residues), 142.8 bits, see alignment E=1.4e-45 PF00939: Na_sulph_symp" amino acids 41 to 178 (138 residues), 34.2 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 83% identical to YBIR_ECOLI: Inner membrane protein YbiR (ybiR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to spt:SPA1917)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>GFF715 Putative membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSLAFLRALRRDRFFQLLIIVGMALSLFVPFAPRAWPGAIDWHTIITLSGLMLLTKGVEL
SGYFDVLGRKMTRRFHTERQLAMFLVLAAAALSTFLTNDVALFIVVPLTITLKKLCAIPV
NRLIIFEALAVNAGSLLTPVGNPQNILLWGRSGLTFAEFSGQMAPLAVMMMLTLLLLCWF
CFPGRALQYHTGTRSPQWQPRLVWSCLALYVVFLTALELRQELWGLVLVAAGFIVLARRV
IVSVDWTLLLVFMAMFIDVHLLTQLPALQGVFNQVGALSHLGLWLTAIGLSQIISNVPST
ILLLNYVPASTLLAWAVNIGGFGLLPGSLANLIALRMANDRRIWWRFHFYSLPMLAWAAL
VGYGLLQLMP