Protein Info for GFF7146 in Variovorax sp. SCN45

Annotation: Putative oxidoreductase in 4-hydroxyproline catabolic gene cluster

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 10 to 304 (295 residues), 108.3 bits, see alignment E=1.3e-34 PF12831: FAD_oxidored" amino acids 10 to 47 (38 residues), 38.5 bits, see alignment 2.3e-13 PF00890: FAD_binding_2" amino acids 10 to 47 (38 residues), 28.8 bits, see alignment 1.9e-10 PF13450: NAD_binding_8" amino acids 13 to 47 (35 residues), 27.3 bits, see alignment 8.8e-10

Best Hits

KEGG orthology group: None (inferred from 82% identity to vap:Vapar_5217)

MetaCyc: 62% identical to D-hydroxyproline dehydrogenase alpha subunit (Pseudomonas aeruginosa PAO1)
1.14.19.-

Predicted SEED Role

"Putative oxidoreductase in 4-hydroxyproline catabolic gene cluster" in subsystem Proline, 4-hydroxyproline uptake and utilization

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>GFF7146 Putative oxidoreductase in 4-hydroxyproline catabolic gene cluster (Variovorax sp. SCN45)
MNRIATDRCDVLVVGAGPAGMAAAVAAAPSGASIVVIDDNPAPGGQIWRDGPGAALPPAA
RKWREALAAHANIRVRSGTRIVAISAPGELLLEDADGATRMAWRKLVLCTGARELLLPFP
GWTLPGVTGAGGLQALVKAGMPVDGERIVIAGSGPLLLAAAATARAAGAKVLRIAEQASF
ASVARFGASLARWPGKAAQAVGLADGGYRTSSRIVSVHGVAQVESVRLLQGGKETDIACD
RVACGFGLTPNTQLGQLLGCALTPAGNGAQALSVDARQATSVPGIYAAGECTGFGGSERA
LAQGAIAGHAAVGNERAAKALEGERARWNAFAAQLHRSFALAEDIRRMPQADTLVCRCED
VPFSALAACSGWTDAKLHRRCGMGACQGRVCGDAAQFLFGWTPPAPRPPLSPVRIATLAG
LVEPDMADPVDARQ