Protein Info for GFF714 in Xanthobacter sp. DMC5

Annotation: Voltage-gated ClC-type chloride channel ClcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 transmembrane" amino acids 38 to 62 (25 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 135 to 146 (12 residues), see Phobius details amino acids 178 to 204 (27 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 351 to 376 (26 residues), see Phobius details amino acids 384 to 408 (25 residues), see Phobius details amino acids 415 to 434 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 112 to 432 (321 residues), 211.4 bits, see alignment E=1.1e-66

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 75% identity to xau:Xaut_3883)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (598 amino acids)

>GFF714 Voltage-gated ClC-type chloride channel ClcB (Xanthobacter sp. DMC5)
MDAPSPETGRAPAPAERAALRRLVDQAQSIVRARETSLVLIAAIMGVLAGVAASIMSATT
QWMHEVLYWLAPGERLSSSPALASPWLILVPAVGGAAMGLIALALKRWRRHPFVDPIEAN
ALHGGRMSLTDSIIVALQTMVSNGFGASLGLEAGYSQIGSGIASRLGLTFKLRRNDLRIL
VGAGAAAGIGAAFDAPLMGAFYGFEIVIGSYSIPAAAPVLAGTVSAVMTARLLGAHVEPL
HMPLDPNLGPVDILPILFLGLAAAAVAIVIMRLVTTVETLFGMSRIPAPLRPMVAGIGIG
ALALYSPQVLSDGHGALHTQVGSAVTASVAIVFGLKILASALSIGSGFRGGLFFASLFLG
ALMGKLYGGLLALAFPGFHLDPSVAAVVGMGALAVGVIGGPLTMSFLVLEMTRDISLSGF
VMAAAVVTSLTVRETFGYSFSTWRLHLRGETIRGAQDVGWMRDLTVAKMMRTDFPTFPQD
GTLDALRARYALGSTRIVVLVDAAGGYGGLLRLSEAYASLEPGETAVSVLATQRDHVLLP
AMNVKEAALAFDTAKAEDLAVVDDRDNRHLLGLLGESHVLKRYAAELERARRGLGAED