Protein Info for GFF714 in Methylophilus sp. DMC18

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 PF23914: TPR_CcmH_CycH" amino acids 8 to 120 (113 residues), 46.7 bits, see alignment E=2.3e-15 PF13181: TPR_8" amino acids 20 to 50 (31 residues), 16.3 bits, see alignment (E = 6.4e-06) amino acids 87 to 120 (34 residues), 22.8 bits, see alignment (E = 4.9e-08) amino acids 121 to 153 (33 residues), 26.6 bits, see alignment (E = 3e-09) PF13432: TPR_16" amino acids 23 to 86 (64 residues), 24.9 bits, see alignment E=1.5e-08 amino acids 92 to 153 (62 residues), 39.3 bits, see alignment E=5.1e-13 PF00515: TPR_1" amino acids 87 to 120 (34 residues), 34.6 bits, see alignment (E = 7.8e-12) amino acids 121 to 153 (33 residues), 37.8 bits, see alignment (E = 7.8e-13) PF13424: TPR_12" amino acids 87 to 150 (64 residues), 37.9 bits, see alignment E=1.2e-12 PF07719: TPR_2" amino acids 87 to 120 (34 residues), 31 bits, see alignment (E = 1.1e-10) amino acids 121 to 153 (33 residues), 32.6 bits, see alignment (E = 3.5e-11) PF13174: TPR_6" amino acids 88 to 119 (32 residues), 15.8 bits, see alignment (E = 1.3e-05) amino acids 127 to 153 (27 residues), 13.4 bits, see alignment (E = 7.2e-05) PF13176: TPR_7" amino acids 90 to 120 (31 residues), 17.5 bits, see alignment (E = 2.3e-06) amino acids 125 to 155 (31 residues), 19.5 bits, see alignment (E = 5.3e-07) PF13414: TPR_11" amino acids 95 to 131 (37 residues), 40.6 bits, see alignment 1.2e-13 amino acids 128 to 153 (26 residues), 28 bits, see alignment (E = 9.6e-10) PF14559: TPR_19" amino acids 99 to 153 (55 residues), 28.3 bits, see alignment 1.3e-09 PF13431: TPR_17" amino acids 109 to 141 (33 residues), 31.2 bits, see alignment (E = 1.1e-10) PF13374: TPR_10" amino acids 123 to 150 (28 residues), 18.5 bits, see alignment (E = 1.2e-06) PF13844: Glyco_transf_41" amino acids 226 to 377 (152 residues), 82.7 bits, see alignment E=1.3e-26 amino acids 397 to 580 (184 residues), 147.6 bits, see alignment E=2.7e-46

Best Hits

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (593 amino acids)

>GFF714 hypothetical protein (Methylophilus sp. DMC18)
MTDQLAKLQQQLSRTPDDPELHYELGRYYLQTKQANAAESAFQHALQLVPEHPQILMQLG
NVASLRGDETLAATFFRRSLAQDKQQADVHFNLANSLRKLGQTALAIQHYQQSLQLDPQD
AECHNNLGNAYREQGQLDLAVASYARALQLNPKLLHAKVHWIHQKQHMADWQGLEQAIAE
VRHALQALPQAQIPPFAFLAMPGTTDQEQLACASRWAQQHYAHIQPLAAPAAKLAGARIK
VAYLSSDFRKHPLAYLVTEVIAAHHREQFEILIYSNSHNDQSAEWHAFHAAADQWLEISN
MTDEAVAQHMRAAEIDLLVDLTGFTQRSRSGVAAYKPARKQVNWLGYPGSMGMLNGVPLY
DAIIVDEILAEVALAEKAIILPCYQPNNARRPTTDAGSRHSHGLPEQGFVFCCFNQSFKI
TPEVFACWMRILKQVPGSVLWLLEGNVWAAKHLTNAAMALGVAADRLIFAPRTSIEQHIA
RQQHADLMLDTAPYNAHTTASDALWQGIPLLTVQGSTFPARVSTSLLKQLGLEECICQDW
QALEQRAVMLAQTPAALAAIKARLQNHANRLFSPDNFCRQLEQAYQQLLLPSG