Protein Info for PS417_03620 in Pseudomonas simiae WCS417

Annotation: glutamate racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR00067: glutamate racemase" amino acids 7 to 248 (242 residues), 219.3 bits, see alignment E=2.8e-69 PF01177: Asp_Glu_race" amino acids 17 to 215 (199 residues), 87.8 bits, see alignment E=4.8e-29

Best Hits

Swiss-Prot: 78% identical to MURI_PSEP1: Glutamate racemase (murI) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K01776, glutamate racemase [EC: 5.1.1.3] (inferred from 93% identity to pfs:PFLU0741)

MetaCyc: 39% identical to glutamate racemase monomer (Mycobacterium tuberculosis H37Rv)
Glutamate racemase. [EC: 5.1.1.3]

Predicted SEED Role

"Glutamate racemase (EC 5.1.1.3)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Peptidoglycan Biosynthesis (EC 5.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXP8 at UniProt or InterPro

Protein Sequence (264 amino acids)

>PS417_03620 glutamate racemase (Pseudomonas simiae WCS417)
MVKGAPIGVFDSGVGGLSVLDEIQQLLPHESLLYVADCGHIPYGEKTPAFIRERSRLVAE
FFREKGAKAFVIACNTATVAAVADLRQDYPDWPLVGMEPAVKPAAAATRSGVVGVLATTG
TLQSAKFAALLDRFATDVRVITQPCPGLVELIETGDLNSPALRKMLQGYIEPLLSAGCDT
IILGCTHYPFLKPLLAQMLPPSIILIDTGAAVARQLKRLLGERDLLADGKPEPAQFWTSG
DVYQLRNILPTLWKYPGVVRSFGA