Protein Info for GFF7117 in Variovorax sp. SCN45

Annotation: 2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00561: Abhydrolase_1" amino acids 30 to 261 (232 residues), 102.6 bits, see alignment E=5.9e-33 PF12146: Hydrolase_4" amino acids 31 to 260 (230 residues), 56.6 bits, see alignment E=4.8e-19 PF12697: Abhydrolase_6" amino acids 31 to 262 (232 residues), 65 bits, see alignment E=3.3e-21

Best Hits

Swiss-Prot: 50% identical to DMPD_PSEUF: 2-hydroxymuconate semialdehyde hydrolase (dmpD) from Pseudomonas sp. (strain CF600)

KEGG orthology group: K10702, 2-hydroxy-6-oxohepta-2,4-dienoate hydroxylase [EC: 3.7.1.-] (inferred from 52% identity to tcu:Tcur_0531)

MetaCyc: 48% identical to 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase (Pseudomonas putida F1)
2-OH-6-OXOHEPTA-2-4-DIENOATE-HYDR-RXN [EC: 3.7.1.25]

Predicted SEED Role

"2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 3.7.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-, 3.7.1.9

Use Curated BLAST to search for 3.7.1.- or 3.7.1.25 or 3.7.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>GFF7117 2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9) (Variovorax sp. SCN45)
MTSTSSPAIGRSVDASGIQTNYHEAGSGFPVLMLHGSGVGVSGYANWRYTMPEIGRHFRA
IAMDMVGFGYSACPPDAQYSLDYWVDHVIDFLDAMGIEQTHLLGNSFGGGLALAVTARHP
QRVSRLVLMGSIGTEFTAPAAFNAGHGYEPAVERMRTLLKNFTFFPDSITDEAVQLRYQT
STRAGYQSTFEKLFPGSREQKMKAMITPDEQIKAIANEVLLIHGREDRVVPVETSERLFK
LIPKSELHLFGQCGHWSHIDRAAHFNQLVLDFYGRP