Protein Info for GFF711 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 158 to 183 (26 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 253 to 287 (35 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 45 to 308 (264 residues), 94.4 bits, see alignment E=3.5e-31

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 51% identity to svi:Svir_12300)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF711 no description (Variovorax sp. SCN45)
MSGQRHFARRHLIPVTLVAVSACVYVGTALATGQHAQLTLAGVMGLLQRMIALGLVALGQ
NFVMLGGSIDLSVANLISVSAVLASYFMQGDTGAIGHAVVGVLLVAAAVGTVNGLLIARL
GVSPLIATLGVGLVLQGVLTVAFTSLQGKVPQAYQALAYGSVAGVPVAVLILLAVAVAAA
FALTRTVAGAHLFAVGGNADSARLAGIRTSRVLVGAHAMAGLMSGLAGLYLASWLGAGTP
WVGRDGGYDLDSIAAVVIGGTLLAGGRGSIAGTMAGVFVFATIDAVFNMLQIDSFLSQVL
RGLIVVIAVGVYTFRNKGHVA