Protein Info for GFF710 in Variovorax sp. SCN45

Annotation: Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 7 to 9 (3 residues), see Phobius details transmembrane" amino acids 10 to 27 (18 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 309 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 35 to 303 (269 residues), 122 bits, see alignment E=1.3e-39

Best Hits

KEGG orthology group: None (inferred from 46% identity to vma:VAB18032_18325)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF710 Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1) (Variovorax sp. SCN45)
MKRWRNINPALVLLVVLVCTMVFMSPLYQTAPGLMSFLQRAAPLVILTCGASFVLIAGGF
DLSSGALITLVVIGCALITNGDADMTWTAVAAAYAMGLAVGLLNGLVVTRLKVPSIIATL
GGLLSIKGIAMVWSGGAPSGYLPQNLRYLGRGVLREVPLTGTLPIAVIVLAVFVALCFWL
MHRTNFGRLVLMIGDNPVAAELAGAPVRRVRVAAFVLSSLSAVTAGILLGGFSGVSVDVG
TGYDLQAIAAAVIGGVVLLGGRGSIPGACIGALTLYTLFTVLNLLGFSEPLRVAVQGLIL
IGAAALTAWRHQRR