Protein Info for PS417_03605 in Pseudomonas simiae WCS417

Annotation: peptide chain release factor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR00019: peptide chain release factor 1" amino acids 1 to 358 (358 residues), 554.8 bits, see alignment E=3.8e-171 PF03462: PCRF" amino acids 12 to 205 (194 residues), 262 bits, see alignment E=3.6e-82 PF00472: RF-1" amino acids 215 to 323 (109 residues), 145.6 bits, see alignment E=6e-47

Best Hits

Swiss-Prot: 98% identical to RF1_PSEFS: Peptide chain release factor 1 (prfA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02835, peptide chain release factor 1 (inferred from 98% identity to pfs:PFLU0738)

Predicted SEED Role

"Peptide chain release factor 1" in subsystem LMPTP YwlE cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4F0 at UniProt or InterPro

Protein Sequence (360 amino acids)

>PS417_03605 peptide chain release factor 1 (Pseudomonas simiae WCS417)
MKASLLNKLDVLQDRFEELTALLGDGEVISDQTKFRAYSKEYADVEPVVATYKNLLKVQA
DLEGAQALLKDSDPDMREMAVEEVREAKEKLAALEGDLQRMLLPKDPNDGRNVFLEIRAG
TGGDEAAIFSGDLFRMYSRYAERRGWRVEILSENEGEHGGYKEVIARVEGDNVYGKLKFE
SGAHRVQRVPATESQGRIHTSACTVAVLPEPDEQEAIEINPADLRIDTYRSSGAGGQHVN
KTDSAIRITHLPSGIVVECQEERSQHKNRARAMSWLSAKLNDQQTSAAANAIASERKLLV
GSGDRSERIRTYNFAQGRVTDHRVNLTLYSLDEILAGGVDAVIEPLLAEYQADQLAAIGE