Protein Info for GFF707 in Xanthobacter sp. DMC5

Annotation: 30S ribosomal protein S9

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00380: Ribosomal_S9" amino acids 39 to 159 (121 residues), 165.8 bits, see alignment E=2.7e-53

Best Hits

Swiss-Prot: 92% identical to RS9_XANP2: 30S ribosomal protein S9 (rpsI) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02996, small subunit ribosomal protein S9 (inferred from 92% identity to xau:Xaut_4345)

Predicted SEED Role

"SSU ribosomal protein S9p (S16e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>GFF707 30S ribosomal protein S9 (Xanthobacter sp. DMC5)
MAEVLQSLDALGAATVSAQPEAPVHVQKLDKFGRAYATGKRKDAVARVWVRPGTGKITVN
DRDIEVYFARPVLRLMINQPFQVAAREGQYDVVATVSGGGLSGQAGALRHGLSKALTYYE
PELRSPLKKGGFLTRDSRVVERKKYGRAKARRSFQFSKR