Protein Info for GFF7067 in Variovorax sp. SCN45

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF00106: adh_short" amino acids 13 to 212 (200 residues), 159.6 bits, see alignment E=1.1e-50 PF08659: KR" amino acids 16 to 188 (173 residues), 74 bits, see alignment E=2.3e-24 PF13561: adh_short_C2" amino acids 19 to 220 (202 residues), 122.1 bits, see alignment E=4.4e-39

Best Hits

Swiss-Prot: 51% identical to Y0148_MYCTU: Putative short-chain type dehydrogenase/reductase Rv0148 (Rv0148) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_3635)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF7067 Oxidoreductase, short-chain dehydrogenase/reductase family (Variovorax sp. SCN45)
MSSSNSSIDFKGRVAIVTGAGGGLGRQHALALAARGAKVVVNDLGGARDGSGGSVSAAQA
VVDEIKAAGGEAIANGASVTDFDAVQAMVKEAVDAWGRVDILVNNAGILRDKSFAKMELA
DFKLVVDVHLMGAVNCTKAVWALMNEQKYGRIVMTTSSSGLYGNFGQSNYGAAKLALVGL
MQTLSIEGAKNDIRVNCLAPTAATRMTEDLFPKEMLEAFRPEAVVPAMLVLAAQDAPNRT
ILCAGAGTFEAAHITLTQGAWLGIEADTPEQLAARLSEVTERQGEVVPQSGAAQGSNEVA
KGMANAKRG