Protein Info for GFF705 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 transmembrane" amino acids 73 to 94 (22 residues), see Phobius details TIGR00369: uncharacterized domain 1" amino acids 38 to 143 (106 residues), 41.2 bits, see alignment E=7.8e-15 PF03061: 4HBT" amino acids 59 to 132 (74 residues), 48.4 bits, see alignment E=9.7e-17 PF13622: 4HBT_3" amino acids 61 to 143 (83 residues), 25.6 bits, see alignment E=1.2e-09

Best Hits

KEGG orthology group: None (inferred from 85% identity to xau:Xaut_4342)

Predicted SEED Role

"Phenylacetic acid degradation-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>GFF705 hypothetical protein (Xanthobacter sp. DMC5)
MDGMTAARDAVMTVKELETFLAAEFPQAFGPGRAHHVERVGLKTATVRLDADESHLRPGG
TISGPAMMALADVAVYVALLAQIGPVALAVTTNLSINFLRKPAPGPLFGDARIIKLGKRL
AVGEVGIRGPGDDELVAHCVATYSIPDRPKA