Protein Info for PS417_03575 in Pseudomonas simiae WCS417

Annotation: ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF13793: Pribosyltran_N" amino acids 4 to 121 (118 residues), 172.1 bits, see alignment E=5.3e-55 TIGR01251: ribose-phosphate diphosphokinase" amino acids 4 to 313 (310 residues), 407.9 bits, see alignment E=1.1e-126 PF00156: Pribosyltran" amino acids 158 to 255 (98 residues), 72.4 bits, see alignment E=4.1e-24 PF14572: Pribosyl_synth" amino acids 202 to 313 (112 residues), 119.4 bits, see alignment E=2.9e-38

Best Hits

Swiss-Prot: 98% identical to KPRS_PSESM: Ribose-phosphate pyrophosphokinase (prs) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 98% identity to psb:Psyr_0944)

MetaCyc: 67% identical to ribose-phosphate diphosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFM5 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PS417_03575 ribose-phosphate pyrophosphokinase (Pseudomonas simiae WCS417)
MSKMMVFTGNANPDLARRVVRQLHIPLGDISVGKFSDGEITAEINENVRGKDVFIIQPTC
APTNDNLMELVVMADAFRRSSATRITAVIPYFGYARQDRRPRSARVAISAKVVADMLTVV
GIDRVLTVDLHADQIQGFFDIPVDNIYGSPVLVDDIEDQRFENLMIVSPDIGGVVRARAV
AKSLGVDLGIIDKRREKANHSEVMHIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGA
AKVFAYCTHPVLSGRAIENIENSVLDELVVTNTIPLSAAAQACARIRQLDIAPVVAEAVR
RISNEESISAMFR