Protein Info for GFF7019 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details amino acids 149 to 176 (28 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details PF12911: OppC_N" amino acids 30 to 71 (42 residues), 38.9 bits, see alignment 6.5e-14 PF00528: BPD_transp_1" amino acids 119 to 301 (183 residues), 109.9 bits, see alignment E=1.3e-35

Best Hits

Swiss-Prot: 35% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 93% identity to vpe:Varpa_4439)

Predicted SEED Role

"Putative polyamine transporter; Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>GFF7019 ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MSKVIAMPPVASASQPAARPPVRVEHPGMEALRMFLRNPAAIAGMAMLLIVLAVAIAGPW
VYPADPFEIKAAPLTPPFSEDAWLGSDYLGRDVLTALIYGGRATLLVGAVAALLSVLIGI
TLGAFAGYYGGKIDAALMKLTEFFQVLPALLFAMVVVTLFSPTLVTVTLAIGIVSWTGTA
RLTRAEFMKYRGLEFVRAERAIGAGDARIIWKVILPNALPPLVVSATLAIGAAILFEAGL
SFLGLGDPNQMSWGLMIGSSRQYVLSCWWAVAFPGAAIFITVLAVSLIGDGLNDALNPKL
RER