Protein Info for GFF7011 in Variovorax sp. SCN45

Annotation: Taurine ABC transporter, permease protein TauC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 122 to 291 (170 residues), 110.1 bits, see alignment E=5.6e-36

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 96% identity to vpe:Varpa_4430)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF7011 Taurine ABC transporter, permease protein TauC (Variovorax sp. SCN45)
MHEVVTVASPAAVMTQPPPSKPAAPPAPAVAGAKLKTSAFKVPGEGSSVTISVVTVVALV
ALWFIVTNMGWVKPLFLPTPQAVFQQFYEYLTGQANDKPLWQHFLASMFRVFSAFFLACA
TAIPVGIAMGMSRFWRGIFDPPLEFYRPLPPLAYLPLIIIWFGIDELPKVLLIFLSCFAP
LALAARSGMRSASQEQINAAYSMGASYMQVIRHVILPSALPDILVGMRIAIGFGWTTLVA
AEMVAANMGLGQMVLNASNFLRTDIVIMGIIVIGVVAYLFDLLMRWLERRLVPWKGRM