Protein Info for GFF701 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 45 to 77 (33 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 226 to 250 (25 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 274 (267 residues), 125.2 bits, see alignment E=1.4e-40

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 88% identity to pna:Pnap_3520)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>GFF701 ABC transporter, permease protein 1 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MQILTQLIFSGIALGMIYAVIAFGYQLTFATSDTLNFGQGNALMLGAMVGLTLVNMGLNY
WLMIPLVCLFGAFQGAVVERIAVRPAIKIKSEFGWIMSTIALGIIFTNVAENVWGRDDLK
FPSPLPESPLHFLGANVLPMEILVVIGALLMMLAVELFNRRSIYGKAVVATFNDRDAAKL
MGINTGLVITFSYALSSMTAAFAGVLIAPLTLTGASMGAVLGLKAFAVAIIGGLTSGMGI
VVGGIILGIAETTTGFYLSTGYKDVPGLVLLLIVLAVRPSGLFGKAAIKKV