Protein Info for GFF7005 in Variovorax sp. SCN45

Annotation: Flagellar biosynthesis protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details PF01312: Bac_export_2" amino acids 7 to 347 (341 residues), 340.3 bits, see alignment E=6.4e-106

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 86% identity to vap:Vapar_2261)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>GFF7005 Flagellar biosynthesis protein FlhB (Variovorax sp. SCN45)
MAEQDLDRNEAATPYKLQRARERGQAAKSTDVVGAIVFTVAAVYLTWRGFGAVATQFRFD
QAVLIQAGRMDPSGAGLWPLTERALRAVFVLSAPFFATVMLAAVVGNMMQTGPMLSFDPV
KMDFNRINPVNGLKRLFSMRVLFDTARALIKLTLLGLVSVLALKALLGQFYGLASLSPIG
YLRTLLDDLSSVALKMALVLGLIALLDLMYTRREFAKKMRMSQRDIKDEAKHRDGDPRIR
ARLRELRRETLKRSLALRETRNADVLITNPTHFAVALKYDHGRMVSPQLLAKGSGHMAAA
MREIAARHGIPVVQNPPLARRLYRELPVDQAVPPELYAQVARIIVWVFAMREQRQGLVAK
GVQA