Protein Info for GFF7004 in Variovorax sp. SCN45

Annotation: Flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 101 to 127 (27 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 275 to 292 (18 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details PF00771: FHIPEP" amino acids 23 to 693 (671 residues), 798.7 bits, see alignment E=2.4e-244

Best Hits

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 87% identity to vap:Vapar_2262)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (703 amino acids)

>GFF7004 Flagellar biosynthesis protein FlhA (Variovorax sp. SCN45)
MKALAKVFEKHSDIALVLLVLGVLVVLFAPIPSGLLDFLILTNFSFAFLVLLLTFYMARP
VEFSTFPSLLLIATLFRLSLNVAATRLILSDGDAGRVIGAIGAFVVGGNYVIGLIVFLIL
IVVQYVVVTSGAQRVSEVAARFTLDSMPGQQMSIDADLNMGFIDQAEAQRRRKNIEKEAG
FYGAMDGASKFVKGDAIAGIIILLINIIGGLVIGVMQHGLPWGQALQTYTLLTIGDGIVT
QVPALVIAVGTGIIVTRSSSDTNLSREALRQVSSFPKTLLMVALALGGLLVLPGIPAIPT
LVLTAGFLLAATLLYRAAKVKSDNAAQGMGDPIDPENLAAADGTAAAAASDDPYTLLQVE
PVEVHLGGNWGPVINQPGSVFMERIASFRKQHANEFGLVLPRVRFKDSSRLSADRYEIHL
DGVLVGKGEARADRLLAIHPSGDTKSIPGEPTRDPTYGLPALWIEERQREAAAQAKFTLV
DAPTVFMTHLTEMLRRESATLLTRSEVDRLLSRVRKSQPGLVEELIPTVLSASDVQKVLQ
NLLREKVSIRHVEAILETLADAGRATRDTAQLTEIVRQRLGHAICQGLIGEASALQVLTL
DPAIESQFLQSMQIAVGEAGATTAAGTQPFVIDPRLSEQLIKRLVQQAERMMKSNLLPVL
LCAPELRRHVRGLSERVMPHLRVLSMAEVPHTIELKSFGIVQL