Protein Info for GFF6985 in Variovorax sp. SCN45

Annotation: Flagellar biosynthesis protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 58 to 87 (30 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 195 to 220 (26 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 61 to 256 (196 residues), 261.8 bits, see alignment E=1.9e-82 PF00813: FliP" amino acids 61 to 252 (192 residues), 255.6 bits, see alignment E=1.7e-80

Best Hits

Swiss-Prot: 47% identical to FLIP_BACSU: Flagellar biosynthetic protein FliP (fliP) from Bacillus subtilis (strain 168)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 61% identity to hch:HCH_04067)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>GFF6985 Flagellar biosynthesis protein FliP (Variovorax sp. SCN45)
MVACSLLGWPAAAAVAQSNEGPLPNATTAGAASGAAKKTSSSNASNPTTETAQALRVVLG
LTVLAILPSLLVCLTSFLRIIVVLSMLRHAIGMNETPPNTVLIGLALFLTLFTMSPVLQK
VNQDAFEPFMAGKLSMEEGYGKGVAPLRDFMVRQTREADLALMVELSKAPAPRSMDDIGN
VQLIPAFMLSELRAAFQIGFVIFLPFLLIDLIVSSILMALGMMMMPPTTIALPLKILMFV
LVDGWSLVLKALVGSFH