Protein Info for GFF698 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Heme O synthase, protoheme IX farnesyltransferase (EC 2.5.1.-) COX10-CtaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 53 to 77 (25 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 281 to 298 (18 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 19 to 299 (281 residues), 316.4 bits, see alignment E=1.1e-98 PF01040: UbiA" amino acids 33 to 284 (252 residues), 227 bits, see alignment E=1.2e-71

Best Hits

Swiss-Prot: 82% identical to COXX_POLSJ: Protoheme IX farnesyltransferase (ctaB) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 82% identity to pol:Bpro_1254)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>GFF698 Heme O synthase, protoheme IX farnesyltransferase (EC 2.5.1.-) COX10-CtaB (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTAPTPPVAAALPSVWRQYHALTKPRVIQLIVFCALIGMVLAVPGAPTWAQVQLAAVAC
FGIWLVAGAAAAFNCVVEQHIDAKMKRTAWRPTAKGQLTNGKTLTFSAVLCAAGSAVLYL
WVNPLTMWLTFATFVGYAVVYTVILKPLTPQNIVIGGASGAMPPVLGWAAMTGVVSPEAL
ILFLIIFLWTPPHFWALALYRVEDYRKSGLPMLPVTHGSEFTRLQILLYTFVLFAACLMP
FVMRMSGWLYLVVAVVLSIGFCGYAFALWRNYSDALARKTFRFSLIHLAVLFAALLVDHY
V