Protein Info for GFF6970 in Variovorax sp. SCN45

Annotation: Chromate transport protein ChrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 155 to 187 (33 residues), see Phobius details amino acids 207 to 233 (27 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 304 to 330 (27 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 375 to 405 (31 residues), see Phobius details PF02417: Chromate_transp" amino acids 20 to 185 (166 residues), 146.1 bits, see alignment E=5.2e-47 amino acids 234 to 402 (169 residues), 125.5 bits, see alignment E=1.1e-40 TIGR00937: chromate efflux transporter" amino acids 25 to 401 (377 residues), 351.4 bits, see alignment E=4.4e-109

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 72% identity to rfr:Rfer_2824)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>GFF6970 Chromate transport protein ChrA (Variovorax sp. SCN45)
MPPEKHIQLAAVEQRGNAFEVLLAFLKLGLTSFGGPVAHLGYFRAEIVERRRWLDERSYS
DLVALCQFLPGPASSQVGLAIGLTRAGWLGALAAWCGFTLPSAFALILFAYGIEHWGTLA
GSGAVHGLKVAAVAVVAQAVWGMAKNLCPDRMRAAMALVAALLVLVLPTALSQVIAITVA
GVVGWRLLELPPQQAVVHRSYGVSRRAGAIALVLFFGLLAGLPIIAAVTQSLLWTVIEGF
YRAGALVFGGGHVVLPLLQATVVPAGVVTNEQFLAGYGAAQAVPGPLFTFAAYLGAVMHG
PFAGWTGGIALLVVIFVPAFLLVVGAVPFWDALRQRKGVQSAMAGVNAAVVGILLAALYD
PVWTSAIHTRTDFATALAAFALLVYARVSPVIVVFLAAAVGWAFLG