Protein Info for GFF6956 in Variovorax sp. SCN45

Annotation: Heavy-metal-associated domain (N-terminus) and membrane-bounded cytochrome biogenesis cycZ-like domain, possible membrane copper tolerance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 59 to 79 (21 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details PF13386: DsbD_2" amino acids 8 to 213 (206 residues), 106.6 bits, see alignment E=8.5e-35

Best Hits

KEGG orthology group: K09792, hypothetical protein (inferred from 71% identity to vap:Vapar_2825)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>GFF6956 Heavy-metal-associated domain (N-terminus) and membrane-bounded cytochrome biogenesis cycZ-like domain, possible membrane copper tolerance protein (Variovorax sp. SCN45)
MQLALAGAALLMGLAGGPHCAAMCGAASSAVIRIVPLPVAGRGAVAGFGAPGAFHLGRIA
SYAAAGAVAAASADSLALASTQVSALRPLWVLLHVFVFAWGAMLAVTGRQPLWARRIGRA
LESRLRPHAGGTWLGVLATGLLWVGLPCGMLYSALMLASLGNGPMQGGLLMALFAVGSSA
SLLIGPWIWLRLAGDGVRQAWGARLAGVLLAAAAAHAVWSDLIRQIDAWCR