Protein Info for GFF6939 in Variovorax sp. SCN45

Annotation: ABC-type antimicrobial peptide transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 301 to 329 (29 residues), see Phobius details amino acids 338 to 365 (28 residues), see Phobius details PF12704: MacB_PCD" amino acids 25 to 229 (205 residues), 41.7 bits, see alignment E=1.7e-14 PF02687: FtsX" amino acids 260 to 374 (115 residues), 39.2 bits, see alignment E=7e-14

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 75% identity to hse:Hsero_2389)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>GFF6939 ABC-type antimicrobial peptide transport system, permease component (Variovorax sp. SCN45)
MKYGGILRIGFKLLVNDRAKFSALLIGITFAVFLMMQMTAMFAGILNRAYSTVTNVGAAM
WIMDPGVNTPTSAIALPDYLLDSVRSMDGVSYAVPMFVGGALVRLDSGTYQSVTVVGLDD
TSLLGRPEIEQGRLEDIYADNSFFVVDDAEFPKLENPHIGSTFELNDNRGVIVGIAKVAS
NGLNGVPTLYTTYSRAIQYLPTTRFTISYVLVQPRDAMAVARIKREVARLGYVALTRKEF
NQATADYYTYKTGIGTNILIMTVISFLVGLSISGQTFYSFILENLEKFGALKAIGAKGTE
LIFMIFFMATFTALTGFGLGVGLVTLMITVARTQLPSYAAIVTFWNLGLAFAMVLVIAGI
SSYFGIRRVLRIEPFDIFRG