Protein Info for GFF6938 in Variovorax sp. SCN45

Annotation: Efflux transport system, outer membrane factor (OMF) lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 24 to 483 (460 residues), 409 bits, see alignment E=1.3e-126 PF02321: OEP" amino acids 82 to 270 (189 residues), 46.3 bits, see alignment E=2.2e-16 amino acids 301 to 481 (181 residues), 81.7 bits, see alignment E=3.1e-27

Best Hits

KEGG orthology group: None (inferred from 54% identity to gur:Gura_1297)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein, NodT family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>GFF6938 Efflux transport system, outer membrane factor (OMF) lipoprotein (Variovorax sp. SCN45)
MTGTPAPGWRWLAAVLALAGTGLSAGCMVGPDFVRPAPAQVDSYTRGALPATTEAGDGRS
QRFGPAAELPADWWRLFGSPALDEAVRQALQHNPTLQSAEASLRQSQDELRAGHGIFYPQ
LDASFGATRARTAPVLQGSSAAGTIYQVVTLSGAISYPLDVFGGERRTVEGLAAQAENQR
FVAMAAYLALEANLVQTCVARAAYVAQRRTTEELIALERDQLHSIEAQVHAGTVPYANQL
SQLSLIASNRAQLAALAQKISQADHLLAALQGDTPAEAALPDVDIGELTLPRDLPLSLPS
ELVRQRPDILAAEAQLHAASAAIGVATAAMFPSFSLSAGYGAASPQLASLLAGGSRYWSL
APAVALPLLHGGTLRARRQAAIDAHAAREADYRQTVLSAFEQVADALRALEHDAQALQAQ
AEARSSAADALALQQAGYRAGLVAYVDLQNADIQFHAASLSYLSALAQRHQDTVALFAAL
GGGWWNAPSSGAGARAGQP