Protein Info for GFF693 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cytochrome c oxidase polypeptide III (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 229 to 252 (24 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details PF00510: COX3" amino acids 12 to 119 (108 residues), 38.3 bits, see alignment E=7.3e-14 amino acids 129 to 292 (164 residues), 167 bits, see alignment E=3.9e-53

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 85% identity to dia:Dtpsy_2855)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF693 Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAATHGTTPYYFVPGPSRHPVMAAIGLFFVILGAGQWVNGHGWGAYSLAFGLAFWLVVL
FQWFRDSVRESEGGLYGHKIDLSFRWSMSWFIFSEVMFFGAFFTALWWTRTHSVPALGNI
ENALIWPDFSAVWPSLQAGATASPAGIVEPFQTMGPFWLPTINTALLLTSGVTLTIAHHA
LQVGNRGKTIAFMWMTVLLGIVFLFVQGYEYAHAYADLNLKLSSGVFGSTFFMLTGFHGF
HVFVGMLMLLFITLRLQKGHFTAERHFGFEGAAWYWHFVDVVWLGLYILVYWM