Protein Info for GFF6927 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, ArsR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 transmembrane" amino acids 82 to 101 (20 residues), see Phobius details PF01022: HTH_5" amino acids 30 to 74 (45 residues), 54.2 bits, see alignment E=1.6e-18 PF01638: HxlR" amino acids 32 to 76 (45 residues), 23.4 bits, see alignment E=6.7e-09

Best Hits

Swiss-Prot: 47% identical to BIGR_XYLFA: Biofilm growth-associated repressor (bigR) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: None (inferred from 78% identity to mpt:Mpe_A2719)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>GFF6927 Transcriptional regulator, ArsR family (Variovorax sp. SCN45)
MKNSTLAIDPEVLRGAAGKAVAALKLLANEDRLLLLCQLSQGEMCVSDLEQALGIHQPTL
SQQLGVLRNEGVVNTRREGKSIFYSVADPAMLELLGVLYRLYCPQEK