Protein Info for PS417_03520 in Pseudomonas simiae WCS417

Annotation: secretin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details PF03958: Secretin_N" amino acids 134 to 186 (53 residues), 29.8 bits, see alignment 5.9e-11 amino acids 197 to 329 (133 residues), 47.4 bits, see alignment E=1.9e-16 TIGR02516: type III secretion outer membrane pore, YscC/HrcC family" amino acids 290 to 548 (259 residues), 261.2 bits, see alignment E=7.7e-82 PF00263: Secretin" amino acids 387 to 547 (161 residues), 116 bits, see alignment E=1.4e-37

Best Hits

KEGG orthology group: K03219, type III secretion protein SctC (inferred from 91% identity to pfs:PFLU0721)

Predicted SEED Role

"Type III secretion outermembrane pore forming protein (YscC,MxiD,HrcC, InvG)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9W0 at UniProt or InterPro

Protein Sequence (713 amino acids)

>PS417_03520 secretin (Pseudomonas simiae WCS417)
MHNTICKRSDLRINSRETSSRRFNWSSLVALACLLSPAHNALAAIPPEWKNTAYAYEADH
KPLREVLEDFAQTFGTQLQIEGLLEGDVNGKIRANTPQSLLDRLGVEHRFQWFLYNNTLF
ISTLDQQESARLEVSSETISDLKQALTDIGLLDSRFGWGELPEDGVVLVSGPKRYIEQIK
QFSSQRRSPDEKQSVLSYPLKFANAADRQVDYRGEKLVVPGVANILRGLLEPRSPSALTG
LTQRPASQPAPLTPNVPRLGNPLLSQMLDANGTTGQMAPMPALTSRAPVSTSRIRVEADV
RNNAVLIYDLPERQTMYRELITQLDVARKLIEIDAIILDIERTQLREFGVNWGFQNSRFR
GGVNMAPGTSSQLSIDNRDRFYADIRALEAKGLATMVSNPSVLTLENQPAVIDFNRTQYI
TPGRDYATILPVTVGTSLQVVPRVTTGRGVHQIHLAVDIEDGNFDETNPDRDPNHPDVRR
GKVSTQAVMQEKRSLVVGGFHVTDSSDQQKKIPLLGDIPLLGKALFSSTERHNNRRERLF
ILTPRVIGDQDDPSRYLPQDDQAELQAALAPLARRYSPHQPVIKRSDIITTLARLVSGEV
PKAFSAAPMPLALNTLCSTRDLLALNTDRSQWYAGPEYNVAVVVLRNQFKRNVRIDEKEC
SNSQTLAVTVWPRAWLKPGEEAEVFIAMRPVVRDEHLSVPRPSMITPAQKATP