Protein Info for GFF6916 in Variovorax sp. SCN45

Annotation: Methyltransferase type 11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF13489: Methyltransf_23" amino acids 22 to 150 (129 residues), 42.8 bits, see alignment E=1.2e-14 PF03848: TehB" amino acids 28 to 139 (112 residues), 22.8 bits, see alignment E=1.3e-08 PF13649: Methyltransf_25" amino acids 44 to 139 (96 residues), 37.9 bits, see alignment E=6e-13 PF08242: Methyltransf_12" amino acids 45 to 140 (96 residues), 32.2 bits, see alignment E=3.7e-11 PF08241: Methyltransf_11" amino acids 45 to 142 (98 residues), 29.7 bits, see alignment E=2.1e-10

Best Hits

KEGG orthology group: None (inferred from 68% identity to axy:AXYL_04274)

Predicted SEED Role

"Methyltransferase type 11"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>GFF6916 Methyltransferase type 11 (Variovorax sp. SCN45)
MSEVQGTAGYGANAAALAQQYESLRFEDVHREVLHLFPAVPARVLDIGAGSGRDAAALAA
LGHRVVAVEPTPELRAEGMRRHAALPIEWIDDHLPGLHRTRALGVRHDLILLTAVWMHLD
AAERAAAMQALAALVAEGGQVAMSLRHGPVPEGRRMFDVSAQETAELASRHGLRQRFLGE
REDMLDRCDVRWSFLVLQRPA