Protein Info for GFF6910 in Variovorax sp. SCN45

Annotation: Xanthine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 196 to 222 (27 residues), see Phobius details amino acids 240 to 265 (26 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details amino acids 405 to 428 (24 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 18 to 396 (379 residues), 238.5 bits, see alignment E=5.4e-75

Best Hits

Swiss-Prot: 31% identical to PUCJ_BACSU: Uric acid permease PucJ (pucJ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 68% identity to sme:SM_b20289)

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>GFF6910 Xanthine permease (Variovorax sp. SCN45)
MSRACDAPAVDAVLPVSQLLLFGLQHVLVMAAVPITSVFLVAKALGLEPALTVNLISATF
LLCGVGTLLQSFGPWKFGARLPFVMVPGGAPIVMFVTIAQQRDLQTASGAVILTALFYFL
VLPVFARCLRYFPKIVIGTLLLLVSINLVKVYGGIIAGKAGSPAFADPVNIGLALATIGF
TVLFARLFKGTLGQLSVLLGLLAGTVLAAVCGLMDFSAVAAGPFWSAPTLLPFGMPRFDL
VAAVPLLIFSVISMVEATGQTVAVAEVVGRKIDARDVVPRTIRGDALVSLAGGLFGTSMI
VTSGENIGIVRATNVRSRYVTATAGVILILIALSAPLGRLASAIPSAVVGGTAMVVFAII
GTMGIDMLRKVDLHERGNMFVLAGALTMGLLPIVVPGLYSRFPDTLQLVLGNGLAMGSLT
AVVLNMVFNRLPAEGAENSAIAPAPH