Protein Info for GFF691 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 PF12831: FAD_oxidored" amino acids 46 to 457 (412 residues), 245 bits, see alignment E=4.6e-76 PF01134: GIDA" amino acids 46 to 81 (36 residues), 20.5 bits, see alignment 5.7e-08 PF00890: FAD_binding_2" amino acids 46 to 90 (45 residues), 20.5 bits, see alignment 6.4e-08 PF13450: NAD_binding_8" amino acids 48 to 83 (36 residues), 29.6 bits, see alignment 1.8e-10

Best Hits

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_3215)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>GFF691 hypothetical protein (Variovorax sp. SCN45)
MKTVVRTDERILSSDIFDRDSRVKRPDHGSWAEPGKRIPVYHRCGVLVVGGGPSGTAAAA
AAARAGADVALLERYNHLGGLSTGGLVIWIDRMTDWEGKLVIRGFAEELFDRLPAEAIAG
PVREDWGSQDAAKAAHWSQRTAAYHGVVTWSPTIDPERLKLLSQEIVLERKVKLIYHSWA
AIPIVQDGAVKGVVFESKEGRMAIMADVVVDATGDGDLFARAGADYVNDIEEADVHHCMN
TSWLFGGVDMNRWIEFKAGQPEAFTAFMAGGRAQCGLFERPFVSWRNDVALFMGPRQSGY
SALDVDDLTAVEVRSHRAMAAHLDYFRAHAPGFENAYLMLSAPQIGVRHARRLVGVGSVL
RSQWPDGVPLADEIGVSPAVSPKFPNISIPYGALVPQKLDGLLACGRHISCDRNSHGFMR
EIPQCWITGQAAGVAAALASRGGIAPRFVDVGALQSGLLEQGVYLRAAVGQGAASPAAAE
AGA