Protein Info for GFF691 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cytochrome oxidase biogenesis protein Cox11-CtaG, copper delivery to Cox1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details PF04442: CtaG_Cox11" amino acids 28 to 175 (148 residues), 165.1 bits, see alignment E=6.3e-53

Best Hits

Swiss-Prot: 37% identical to COXZ_RHOPB: Cytochrome c oxidase assembly protein CtaG (ctaG) from Rhodopseudomonas palustris (strain BisB18)

KEGG orthology group: K02258, cytochrome c oxidase subunit XI assembly protein (inferred from 74% identity to del:DelCs14_4900)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Cox11-CtaG, copper delivery to Cox1" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>GFF691 Cytochrome oxidase biogenesis protein Cox11-CtaG, copper delivery to Cox1 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAVQRENLKMVGKLCVIALGMFAFGYALVPIYRHICEALGINVLAVSELRVPGAASLPAN
TQVDRTRTITVEFDTNARGPWHFKPAVRSLQVHPGELTTVMYEFQNIQNRTMAAQAVPSY
APKQAAAHFNKLECFCFTQYTLQAGEKKEWPVAFVIDPRLSKDVSTITLSYTFFEVGGKV
PAAPTDDAPQAQSPATLKPTGDV