Protein Info for GFF6904 in Variovorax sp. SCN45

Annotation: Zinc-type alcohol dehydrogenase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 TIGR02817: zinc-binding alcohol dehydrogenase family protein" amino acids 2 to 336 (335 residues), 523.8 bits, see alignment E=1.1e-161 PF08240: ADH_N" amino acids 29 to 88 (60 residues), 55.3 bits, see alignment E=1.1e-18 PF00107: ADH_zinc_N" amino acids 160 to 246 (87 residues), 44.8 bits, see alignment E=1.9e-15 PF13602: ADH_zinc_N_2" amino acids 193 to 333 (141 residues), 61 bits, see alignment E=3.6e-20

Best Hits

Swiss-Prot: 38% identical to ZDH1_STAAR: Zinc-type alcohol dehydrogenase-like protein SAR2277 (SAR2277) from Staphylococcus aureus (strain MRSA252)

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_0754)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>GFF6904 Zinc-type alcohol dehydrogenase-like protein (Variovorax sp. SCN45)
MKAVGYYQPLPIDNPESLQDIELPAPAAGPRDLLVRVKAVSVNPVDTKVRKNAAPEAGQA
KVLGWDAVGTVEAVGSGVRNFKIGDRVYYAGSIIRPGANAELHAVDERIAALAPKSLDDA
QAAALPLTTITAYELLFDRLRVPKDGGEGQTLLITGGAGGVGSILIQLARQLTRLRVVAT
ASRAETREWCLALGAHTVIDHSKPLAAELKAAGIGEVDMVASLTQTEQHYAQIIESLKPQ
GQLAVIDDMKVLDAMPLKTKCISLHWEMMFTRSRFETPDIAEQGALLAEVAALVDAGRIR
TTANASFGTINAANLKKAHALIESGKAQGKVVLAGF