Protein Info for PS417_00350 in Pseudomonas simiae WCS417

Annotation: methionine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF03180: Lipoprotein_9" amino acids 21 to 256 (236 residues), 343 bits, see alignment E=3.5e-107 TIGR00363: lipoprotein, YaeC family" amino acids 33 to 252 (220 residues), 236.1 bits, see alignment E=2.6e-74

Best Hits

Swiss-Prot: 44% identical to METQ_PASMU: Probable D-methionine-binding lipoprotein MetQ (metQ) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K02073, D-methionine transport system substrate-binding protein (inferred from 97% identity to pfs:PFLU0068)

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0G3 at UniProt or InterPro

Protein Sequence (256 amino acids)

>PS417_00350 methionine ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MKKLLVAFAAVAAFSAHAETITVAASPVPHAEILEFVKPALAKEGVDLQVKVFTDYVQPN
VQVAEKRLDANFFQHQPYLDEFNKAKGTHLVSVGAVHLEPLGAYSSKYKKLDELPSGANV
VIPNDATNGGRALLLLAKNGLITLKDPTNILSTIKDITQNEKNLKFRELEAATLPRVLTQ
VDLALINTNYALEAKLDPSKDALVIEGSDSPYVNILVTREDNKDSDAVKKLVAALHTPEV
KKFIEEKYKGAIKPAF