Protein Info for GFF6890 in Variovorax sp. SCN45

Annotation: Threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 42 to 68 (27 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 112 to 137 (26 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details PF01810: LysE" amino acids 16 to 204 (189 residues), 119.4 bits, see alignment E=7.3e-39

Best Hits

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_0763)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF6890 Threonine efflux protein (Variovorax sp. SCN45)
MIGLATLSLFLLAVLALFLSPGPNMAFVLSHGVAHGPRGGFAAALGISAADLVHTLFAAT
GVTALVAAWPPSFDLLRYAGALYLAWLAMQALRDGGGLRIGAKAQPAGFGRIVRMALLNN
LVNPKALLFFMVFLPQFVDPARGSVPLQLVQLGVVLSMAALAFNTLLGACSGQVGRWLHN
RPGAARFQSGLLAAVMLGLAVRLLFLDRPSPR