Protein Info for GFF689 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cytochrome c oxidase polypeptide I (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 201 to 226 (26 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details amino acids 469 to 491 (23 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 27 to 530 (504 residues), 707.7 bits, see alignment E=4e-217 PF00115: COX1" amino acids 35 to 476 (442 residues), 546.1 bits, see alignment E=3.3e-168

Best Hits

Swiss-Prot: 57% identical to COX1_BRADU: Cytochrome c oxidase subunit 1 (ctaD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 91% identity to pol:Bpro_1246)

MetaCyc: 68% identical to cytochrome c oxidase subunit 1 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>GFF689 Cytochrome c oxidase polypeptide I (EC 1.9.3.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAVLDHHDAHGHDDHDHHAPTGWRRWVYATNHKDIGTLYLLFAFTMLMVGGVLALLIRA
ELFQPGLQLVNPELFNQLTTMHGLIMVFGAIMPAFVGFANWMIPLQIGASDMAFARMNNF
SFWLMIPAAIMLVASFFMPGGAPAAGWTLYAPLTLQMGPSMDAGIFAMHILGASSIMGSI
NIIVTILNMRAPGMTLMKMPMFCWTWLITAYLLIAVMPVLAGAITMTLTDRHFGTSFFNP
AGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSQVVPAFARKKLFGYASMVYATGSIAIL
SFVVWAHHMFTTGMPVTGQLFFMYSTMLIAVPTGVKIFNWIATMWKGSMTFETPMLWAVG
FIFVFTIGGFTGLILSVAPIDIQMQDTYYVVAHFHYVLVAGSLFAMFSGIYYWLPKWTGV
MYSETRGKIHFWWSMISFNITFFPMHFLGLAGMPRRYADYPMQFADFNAIASVGAFGFGL
AQVYFFLAVVVPAMRGKGEKAPQNPWEGAVGLEWEVPSPAPFHTFENPPKLDATATKVIG