Protein Info for GFF6882 in Variovorax sp. SCN45

Annotation: dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 2 to 336 (335 residues), 502.9 bits, see alignment E=1.7e-155 PF01370: Epimerase" amino acids 2 to 250 (249 residues), 225.7 bits, see alignment E=1.8e-70 PF02719: Polysacc_synt_2" amino acids 2 to 109 (108 residues), 33.1 bits, see alignment E=1e-11 PF04321: RmlD_sub_bind" amino acids 2 to 174 (173 residues), 43.5 bits, see alignment E=6.5e-15 PF16363: GDP_Man_Dehyd" amino acids 3 to 323 (321 residues), 311.2 bits, see alignment E=3.2e-96 PF01073: 3Beta_HSD" amino acids 3 to 229 (227 residues), 36.7 bits, see alignment E=7.5e-13 PF07993: NAD_binding_4" amino acids 4 to 186 (183 residues), 28.4 bits, see alignment E=2.8e-10

Best Hits

Swiss-Prot: 72% identical to RMLB_XANCB: dTDP-glucose 4,6-dehydratase (rfbB) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 95% identity to vpe:Varpa_0771)

MetaCyc: 60% identical to dTDP-glucose 4,6-dehydratase 1 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>GFF6882 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46) (Variovorax sp. SCN45)
MILVTGGAGFIGANFVLDWIVRNDEPVVNLDKLTYAGNLETLASLKGNPKHIFVQGDIGD
SALIDRLLAEHKPRAVVNFAAESHVDRSIHGPEDFVQTNVLGTFRLLESVRGFWSALPAD
QKAAFRFLHVSTDEVYGSLSKTDPAFTEENKYEPNSPYSASKAASDHLVRAWHHTYGLPV
LTTNCSNNYGPFHFPEKLIPLMIVNALAGKSLPVYGDGMQVRDWLYVKDHCSAIRRVLEA
GRLGETYNVGGWNEKPNIEIVNTVCALLDELRPRADGKPYKEQITYVTDRPGHDRRYAID
ARKLERELRWKPAETFDTGIRKTVEWYLANGDWVSNVQSGAYREWVEKQYDAKASA