Protein Info for GFF688 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cardiolipin synthetase (EC 2.7.8.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13091: PLDc_2
  • amino acids 26 to 163 (138 residues), 52.8 bits, E=3.7e-18
  • amino acids 213 to 337 (125 residues), 103.3 bits, E=8.9e-34
• PF00614: PLDc
  • amino acids 110 to 132 (23 residues), 32.3 bits, see alignment (E = 7.3e-12)

Best Hits

Swiss-Prot: 100% identical to CLSB_SALTY: Cardiolipin synthase B (clsB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06132, putative cardiolipin synthase [EC: 2.7.8.-] (inferred from 99% identity to ses:SARI_02116)

MetaCyc: 86% identical to cardiolipin synthase B (Escherichia coli K-12 substr. MG1655)
CARDIOLIPSYN-RXN [EC: 2.7.8.41]; RXN0-7272 [EC: 2.7.8.41]

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (12/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (11/13 steps found)
• cardiolipin biosynthesis I (3/3 steps found)
• cardiolipin biosynthesis II (3/3 steps found)
• cardiolipin biosynthesis III (3/3 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism
• High-mannose type N-glycan biosynthesis
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.41

Protein Sequence (413 amino acids)

>GFF688 Cardiolipin synthetase (EC 2.7.8.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKCGWREGNQIQLLENGDQFYPAVFEAIAQAQQKIILETFILFEDEVGKKLHTALLKAAQ
RGVKAEVLLDGYGSPDLSDAFVGELTSAGVIFRYYDPRPRLLGLRTNIFRRMHRKIVVID
DRIAFVGGINYSAEHMSDYGPQAKQDYAVRVEGPVVADILQFEVENLPGQSPARRWWKRH
HQAEENRHPGEAQALFVWRDNEEHRDDIERHYLKMLTQAKREVIIANAYFFPGYRLLHAM
RKAARRGVSVKLIVQGEPDMPIVKVGARLLYNYLVKGGVQVYEYRRRPLHGKVALMDDHW
ATVGSSNLDPLSLSLNLEANLIIHDRTFNQTLRDNLQGIIVNDCKQVDESMLPKRTWWNL
TKSVLAFHFLRHFPALVGWLPAHTPHLAQVPPPAQPEMETQDRVDPENTGVKP