Protein Info for GFF687 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details PF10003: DUF2244" amino acids 5 to 140 (136 residues), 149.9 bits, see alignment E=1.9e-48

Best Hits

KEGG orthology group: None (inferred from 70% identity to pol:Bpro_1244)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (143 amino acids)

>GFF687 Probable transmembrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MEWSLKRNCSVTPAQLGWLYASMCVVSLGVAGFFWSQGATLVLPFAVLELIAVAVAFLAY
ARHAADSERIRLLEGRLVVEQEMAGRTKRCEFAREWVRVAPHEEDGQMIELCGGGQSVRV
GRFVRPELRPVLAQEIRQALRGA