Protein Info for GFF685 in Pseudomonas sp. DMC3

Annotation: NAD(P) transhydrogenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details PF12769: PNTB_4TM" amino acids 12 to 95 (84 residues), 120.2 bits, see alignment E=2.1e-39

Best Hits

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 97% identity to psp:PSPPH_5099)

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>GFF685 NAD(P) transhydrogenase subunit alpha (Pseudomonas sp. DMC3)
MEELISPGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAISAIVIVGAMLAAALTV
TPLGKTMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAKEEAPK