Protein Info for GFF6849 in Variovorax sp. SCN45

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 369 to 395 (27 residues), see Phobius details amino acids 464 to 484 (21 residues), see Phobius details amino acids 504 to 528 (25 residues), see Phobius details amino acids 538 to 560 (23 residues), see Phobius details PF10102: DUF2341" amino acids 72 to 137 (66 residues), 68.6 bits, see alignment E=8e-23 PF13385: Laminin_G_3" amino acids 192 to 333 (142 residues), 54.8 bits, see alignment E=1.8e-18 PF01618: MotA_ExbB" amino acids 471 to 571 (101 residues), 93.9 bits, see alignment E=1e-30

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 80% identity to mms:mma_2379)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (602 amino acids)

>GFF6849 MotA/TolQ/ExbB proton channel family protein (Variovorax sp. SCN45)
MRRILFIVLTLLSTLLPGLAHAWWQAEWSYRKPVTIDGGPQAGAIGSDAGRVPVLVRLHT
GNFKFEGVSETGADLRFVAADDKTVLNHQIEQFDPLLGMALIWVDVPNVSAGTPQKLWMY
YGNPKAPASGNGQRTFDPDYTLVYHFAEGAVPPRDTTAYANNGQTAVVPVEGTVIGKGAQ
LGNGALMLPATPSLAVQAGGALTFSAWVKPDQLGARQAIYARRDGAGELVVGIDQGVPFV
QVNGQRSTPGQPIQAGQWSHIAVKAEGESVALYVGGRPTVSLAAKLPALNTAGALGADVA
PTAPAAANAQAAPAAFAPFTGAIDEVRLSKVARADALLLADAVSQGAESRLTVFGADEQQ
AGKSHFGFILAAMPLDAWVVVGLLGLMMALSWAIMIGKGRSYGATSRANAAFIEHFREAA
GAPLDRLAVNNTVPQDVRADSSLWRLYEVAIDEMRRRHDRGYDLNSVSVATIGAIRAAMD
GVMVRETERMSKRMNWLSTTIEGAPYVGLFGTVIGIMLVFVVAAMAGAVDINSVAPGMAA
ALLCTAAGLGVAIPALFGYNWLASRSDAIGADMAVFVDEFVTRLAEEQGEGRSVPQAVAR
RA