Protein Info for GFF6832 in Variovorax sp. SCN45

Annotation: DnaJ-class molecular chaperone CbpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF00226: DnaJ" amino acids 5 to 66 (62 residues), 80.9 bits, see alignment E=5.9e-27 PF01556: DnaJ_C" amino acids 138 to 291 (154 residues), 131.1 bits, see alignment E=3.7e-42

Best Hits

Swiss-Prot: 49% identical to CBPA_COXBN: Curved DNA-binding protein (cbpA) from Coxiella burnetii (strain Dugway 5J108-111)

KEGG orthology group: K05516, curved DNA-binding protein (inferred from 92% identity to vpe:Varpa_2406)

Predicted SEED Role

"DnaJ-class molecular chaperone CbpA" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF6832 DnaJ-class molecular chaperone CbpA (Variovorax sp. SCN45)
MEFKDYYSALGIDRTASDDEVRKAYRKLARKYHPDVSKEPDAEQRMRDINEAKDVLGDKE
KRAAYDALAERVARGGSPDGHFQPPPGWDEGFEFRRGPNQGPADHADFSEFFSSLFGEAE
RRGAARQNYKARGEDHHAAIEIALEDALKGAEREITLRAQTVDAQGHPQWENRTLSVKIP
PGVHPGQFIRLAGQGMPGHGGEPPGDLYLEVRIAPHRLYRVEERDLYMPLPVTPAEAALG
AQVQVPTPTGGVVEVTVPRNARGGMKLRLKGRGLAGKTPGDLYLLIEIALPPADSDDARK
AYEQLAQATASFNPRQHLGV