Protein Info for GFF683 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 49 to 76 (28 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details PF01027: Bax1-I" amino acids 18 to 230 (213 residues), 208.3 bits, see alignment E=5.6e-66

Best Hits

Swiss-Prot: 87% identical to YBHL_ECOL6: Inner membrane protein YbhL (ybhL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06890, (no description) (inferred from 98% identity to ses:SARI_02118)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>GFF683 Putative membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDRFPRSDSIVQARSGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFF
GLIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFVVTG
GMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVVVFVG
LTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR