Protein Info for GFF6829 in Variovorax sp. SCN45

Annotation: Glutathione S-transferase (EC 2.5.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 152 to 161 (10 residues), see Phobius details PF02798: GST_N" amino acids 1 to 75 (75 residues), 56 bits, see alignment E=1.1e-18 PF13417: GST_N_3" amino acids 5 to 80 (76 residues), 47.1 bits, see alignment E=6.1e-16 PF13409: GST_N_2" amino acids 13 to 75 (63 residues), 46.6 bits, see alignment E=1.1e-15 PF13410: GST_C_2" amino acids 122 to 182 (61 residues), 38.1 bits, see alignment E=3.4e-13

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 84% identity to vpe:Varpa_2409)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>GFF6829 Glutathione S-transferase (EC 2.5.1.18) (Variovorax sp. SCN45)
MTMKLYFDPQSRSQVAKWMLDETGAPYEIVTTLIREKAHKKPDYLKINPAGKLPALVDGR
ARVFENAAICMYLAEKFPGKRLAPPVGSVDRGRYLSLMVYSTAQLEPAMGDSLLKIRSNN
SARGWTDFEAAKDAVERELGDGPYLFGSQFTAADVMIGSMFIWHRAFGGRSNRPRIDAYI
NRLQARPKGMKFG