Protein Info for PS417_03470 in Pseudomonas simiae WCS417

Annotation: ATP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR01026: ATPase, FliI/YscN family" amino acids 16 to 447 (432 residues), 494.9 bits, see alignment E=1e-152 PF02874: ATP-synt_ab_N" amino acids 32 to 96 (65 residues), 25.9 bits, see alignment E=1.7e-09 PF00006: ATP-synt_ab" amino acids 158 to 367 (210 residues), 265 bits, see alignment E=7.5e-83 PF18269: T3SS_ATPase_C" amino acids 376 to 445 (70 residues), 71.9 bits, see alignment E=4.8e-24

Best Hits

Swiss-Prot: 66% identical to HRCN_PSESM: Type III secretion ATP synthase HrcN (hrcN) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03224, ATP synthase in type III secretion protein SctN [EC: 3.6.3.14] (inferred from 78% identity to pba:PSEBR_a5386)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9V1 at UniProt or InterPro

Protein Sequence (452 amino acids)

>PS417_03470 ATP synthase (Pseudomonas simiae WCS417)
MSAEMQARLEAWQQRQVQSLATFAPVTMRGRIQRVNGMLLQCRLPQARIGDLCRVEKKPG
DYMLAEIIGFDQQDAVLSALGNLEGVQVGAGVERLGVAHRVQVSEALLGQVLDGFGRPIT
GEGPGAFVEADLPDTSAVLCEAPLPTERPRINRALATGVRSIDGLLTLGEGQRVGLFAGA
GCGKTTLLAEIARNVDCDVIVFGLIGERGRELREFLDHELDEQLRSKAVLVCATSDRSSM
ERARAAFTATALAEGYRRKGLRVLLLIDSLTRFARAQREIGLAAGEPLGRGGLPPSVYSL
LPRLVERAGLTRAGVITAIYTVLIEQDSMNDPVADEVRSLLDGHIVLSRKLAERGHYPAV
DVLASLSRILSNVAEPADIQAGTALRRLLSAYQQIELMLKLGEYQPGSDALTDLAVDSRQ
AVDNFLRQDLREPAPMAATLEQLKELTAYVPF