Protein Info for GFF680 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG00761799: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 57 to 85 (29 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details PF01925: TauE" amino acids 36 to 265 (230 residues), 122.5 bits, see alignment E=1.2e-39

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 78% identity to rfr:Rfer_1586)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>GFF680 FIG00761799: membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRRFSPGGGQGHSPAATIARLNFPLITDPSFYFVAIPAVLLLGVSKSGFGAGFGSLAVPL
MALAVSVPQAAAILMPVLLLMDLLGMAAFRKNFDRRLLMFLVPCSLLGIVIGALLFKWLD
TRVVAGLVGVFTLLFLAQRLLFPPRPDSAPPPRWVGALLTVTSGFTSFVAHAGGPPLNAY
VIPLRLPPAIFAGTLAFLFFFVNLAKWVPYAWLGLLDLRNMATSLALLPFAPLGVWLGVY
IAKRIQPHLFYRLIYLGMFLTGCKLVWDAVAIT