Protein Info for GFF6799 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 94 to 98 (5 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 111 (98 residues), 104.6 bits, see alignment E=1.7e-34 PF00528: BPD_transp_1" amino acids 35 to 216 (182 residues), 71.8 bits, see alignment E=3.2e-24

Best Hits

Swiss-Prot: 38% identical to TCYB_BACSU: L-cystine transport system permease protein TcyB (tcyB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 94% identity to vpe:Varpa_4235)

MetaCyc: 34% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>GFF6799 ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
MNIEFDFGAVLSEWPLLLRGVAWTIGLTAVGTVLGMIVGTFCAWARANGPAWLRIVVGTY
VELIRNTPFIVQLFFIFFGLPAAGVKLSPEVASVIAMVLNLGAYSTEIIRAGIEATPKGQ
IEAAVSLALSKSQVFLRVVLPPALKKVWPAMVSQIVIVMLGSAVCGQISTEELSYAANLI
QSRNFRAFEAFIVATLIYLALSVALRRLLDWAGPKFFFGR