Protein Info for GFF679 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details PF03458: Gly_transporter" amino acids 14 to 87 (74 residues), 62.9 bits, see alignment E=1e-21 amino acids 102 to 176 (75 residues), 78.9 bits, see alignment E=1e-26

Best Hits

KEGG orthology group: None (inferred from 77% identity to pna:Pnap_0870)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF679 Putative membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MHNIQFWGETLRLLVELAATVAFALSGILMGARMRLDAVGVAVVGFLAAFGGGTLRDLLL
DQRPFFWVSHVELLWGVLGLCVLAMAFLRGRHMQLTERAIQWPDALGLGLFTATGVHQAL
LLDMPALVAVLMGLITGVFGGVLRDVVCNEIPTAFKDHRPYALCAFAGGWLYVGLWQIEA
PGWIALVACVVFTAGLRGLALWRNWQLPAWKL