Protein Info for GFF679 in Methylophilus sp. DMC18

Annotation: Methenyltetrahydromethanopterin cyclohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03120: methenyltetrahydromethanopterin cyclohydrolase
  • amino acids 19 to 330 (312 residues), 408.1 bits, E=1.2e-126
• PF02289: MCH
  • amino acids 19 to 329 (311 residues), 420 bits, E=3.1e-130

Best Hits

Swiss-Prot: 64% identical to MCH_METFK: Methenyltetrahydromethanopterin cyclohydrolase (mch) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: K01499, methenyltetrahydromethanopterin cyclohydrolase [EC: 3.5.4.27] (inferred from 64% identity to mei:Msip34_1502)

MetaCyc: 54% identical to methenyltetrahydropterin cyclohydrolase subunit (Methylorubrum extorquens AM1)
Methenyltetrahydromethanopterin cyclohydrolase. [EC: 3.5.4.27]

Predicted SEED Role

"N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase (EC 3.5.4.27)" in subsystem Methanogenesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 3.5.4.27)

MetaCyc Pathways

• methyl-coenzyme M oxidation to CO₂ II (4/6 steps found)
• formaldehyde oxidation VI (H₄MPT pathway) (2/4 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (12/18 steps found)
• methanogenesis from H₂ and CO₂ (3/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (3/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (3/6 steps found)
• methoxylated aromatic compound degradation II (4/9 steps found)
• superpathway of C1 compounds oxidation to CO₂ (5/12 steps found)
• superpathway of methanogenesis (4/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.27

Protein Sequence (331 amino acids)

>GFF679 Methenyltetrahydromethanopterin cyclohydrolase (Methylophilus sp. DMC18)
MSASTSNSISTNEQPSSISVQRYSAPLVAELVANAAALGCAVSTHETGATIVDAGIQVPG
GLEAGRLIAEICMGGLGNVALRHVPQFANWPLSVVVTAKQPVIACLGSQYAGWALSHEKF
FSLGSGPARAIAQREEVFKDINYRDQGEQSVLVLETDKVPPAAVIEKVSKDTGLPANKLT
FILTPTRSVAGSLQVTARVLEVALHKCHALHFDLSAIVDGYGIAPVPAPSPDFIVGMGRT
NDAILFGGFVQLFVNTDDAAAEALATQLPSSASKDYGRPFAEVFKAVNMDFYQIDPMLFS
PAKVSVSNVKTGRTFFAGKFNEDLLNQSFGS