Protein Info for GFF6776 in Variovorax sp. SCN45

Annotation: Maltodextrin ABC transporter, permease protein MdxG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 99 to 271 (173 residues), 55 bits, see alignment E=4.5e-19

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 95% identity to vpe:Varpa_4259)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>GFF6776 Maltodextrin ABC transporter, permease protein MdxG (Variovorax sp. SCN45)
MKRWTPKAIATEAKLLLIGIPVLLWTLIPVYHMALFAFSTKDSATSGHLWPTTPTLANFN
TVFHQKHFYLDHFWLQLWNSLVIALSVGAITLFVATTAAFAISRLRVRGGRTVMNLALFT
YFIPAAFLAVPMYKTMGNYGLLNSQWALILAMVTIASPYCIWVLKQASDKLPYELDEAAR
MDGASPLQLFRLVYLPLMVPSLVAVGTYSLLLAWNEYLYAFLLLSNDKSVTLAVALGNFL
SADDSPWELLMATGLIYALPPAAIYYTFKRYMVGGLTAGAVKS