Protein Info for GFF677 in Methylophilus sp. DMC18

Annotation: NAD(P)-dependent methylenetetrahydromethanopterin dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09176: Mpt_N
  • amino acids 18 to 98 (81 residues), 104 bits, E=1.9e-34

Best Hits

KEGG orthology group: K10714, methylene-tetrahydromethanopterin dehydrogenase [EC: 1.5.1.-] (inferred from 54% identity to meh:M301_1556)

Predicted SEED Role

"Methylene tetrahydromethanopterin dehydrogenase (EC 1.5.99.9)" in subsystem One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 1.5.99.9)

MetaCyc Pathways

• methyl-coenzyme M oxidation to CO₂ II (4/6 steps found)
• methoxylated aromatic compound degradation II (4/9 steps found)
• 3PG-factor 420 biosynthesis (1/5 steps found)
• factor 420 biosynthesis I (archaea) (1/5 steps found)
• factor 420 biosynthesis II (mycobacteria) (1/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Folate biosynthesis
• Methane metabolism
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.-

Use Curated BLAST to search for 1.5.1.- or 1.5.99.9

Protein Sequence (297 amino acids)

>GFF677 NAD(P)-dependent methylenetetrahydromethanopterin dehydrogenase (Methylophilus sp. DMC18)
MKKTSIMHLFTAAKNASPFDVNMAFDAGYEKIISYTDVTLNEIIPLTQDAIFSRSPSGLK
QQALFFGGRDIQVALEMQKQARSAMFKPFECHTFSDPSGAFTTAAAMLAKVDFYLQKSGS
GLGKEKVAIFGASGTVGSTAALIAARQGATVLMVAHAEIASMQAYVDKLSTSYDVKLQVV
DGSNEAAKMAVLNEASVALCATPAGVRVLEVRHFANSKTLKVVADVNAVPPSGIEGVDTF
SNGGMIEGTQVAGFGALAIGQLKYVTQNKLLEQMLQSESPMHIDYHEAYEYACAHVE